PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 312aa    MW: 36319.6 Da    PI: 7.6174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16570.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++  +G g+W++ a++ g++Rt+k+c++rw++yl
       KHN16570.1 19 RGPWTLEEDNLLSQYIFNHGEGRWNLLAKRSGLKRTGKSCRLRWLNYL 66
                     89********************************************97 PP

2Myb_DNA-binding52.31.4e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++++++++ ++G++ W++Ia++++ gRt++++k++w++
       KHN16570.1  72 RGNLTPQEQLIILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 115
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3711466IPR017930Myb domain
SuperFamilySSF466891.83E-2917113IPR009057Homeodomain-like
SMARTSM007179.0E-151868IPR001005SANT/Myb domain
PfamPF002499.3E-161966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-222073IPR009057Homeodomain-like
CDDcd001671.19E-102166No hitNo description
PROSITE profilePS5129425.59567121IPR017930Myb domain
SMARTSM007175.1E-1571119IPR001005SANT/Myb domain
PfamPF002492.5E-1572115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2374120IPR009057Homeodomain-like
CDDcd001675.04E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSTSKSVSSS SEDDNELRRG PWTLEEDNLL SQYIFNHGEG RWNLLAKRSG LKRTGKSCRL  60
RWLNYLKPDV KRGNLTPQEQ LIILELHSKW GNRWSKIAQH LPGRTDNEIK NYWRTRIQKQ  120
ARHLKIYTDS REFQELVRRF WMPRLLQKAK ESSSSNMSIQ NQAIPMPFDY VSQHLTVGTI  180
PPWQGPCMNE AGPTYMDQHE QNSDSEHNNG SCISLSESAN IPKVPQHFGH TTITQFHALN  240
TNDFGTFTYE GYNVNNNVYE MDNFKTTTTR VAEDAQYPIG DCQMVGSNWV DNDFACNMWN  300
MDELWQFSKL QK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25161214108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0941810.0BT094181.1 Soybean clone JCVI-FLGm-18E16 unknown mRNA.
GenBankJX0902520.0JX090252.1 Glycine max ecotype Gwangan Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006584643.10.0PREDICTED: MYB transcription factor MYB184 isoform X1
SwissprotQ9LK953e-61MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0B2Q5K50.0A0A0B2Q5K5_GLYSO; Transcription factor MYB21
STRINGGLYMA08G04670.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.13e-80myb domain protein 116
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]